DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Saf-B and SPAC25G10.01

DIOPT Version :9

Sequence 1:NP_733041.2 Gene:Saf-B / 42958 FlyBaseID:FBgn0039229 Length:928 Species:Drosophila melanogaster
Sequence 2:NP_001342863.1 Gene:SPAC25G10.01 / 3361412 PomBaseID:SPAC25G10.01 Length:297 Species:Schizosaccharomyces pombe


Alignment Length:287 Identity:65/287 - (22%)
Similarity:121/287 - (42%) Gaps:59/287 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 KDADKKNDDG---ARSKKRDEKSGDKKDS-SEQKSSGKSSNQKDDKEKSTAAPGGATSSTASSAA 285
            |||.:.:.|.   |.:..:.:.:|:...| :|.:....:.:...||::..:||.|:.:       
pombe    41 KDAGETDSDAGSIAMNVHQLDTAGEPLQSMNEDEVDPNNESTALDKKEPQSAPEGSEN------- 98

  Fly   286 GSKSGSGSSAGNGTGANSNNKQATLSRNLWVSGLSTLTRASDLKAIFSKFGKVIGAKVVTNTRTP 350
                                    |..:|:|||:::..:..:|:.||||||.|...:::....|.
pombe    99 ------------------------LGNDLFVSGIASRMQEDELQQIFSKFGTVTHVRIMREPVTK 139

  Fly   351 GTRCYGYVTMSSSADASRCIENLHRTELHGRIISVERTKNEIGGSLNSKEGKGKAPG-DAGNKKK 414
            .:|.:|:::.|:..:|:..|:||:..|.:||:::|::.|.    |.......||..| |.....:
pombe   140 ASRGFGFLSFSTVEEATSAIDNLNSQEFYGRVLNVQKAKR----SRPHSPTPGKYMGYDRRRNSR 200

  Fly   415 EDDSGKKSGSGKGSSSNSGDDKKGGDGNGDSKSVGGDLKRDGKESNRARSRRNDDRGKSLASQDR 479
            :..|..|.|..:.::....|..:..:....|:.     :|:....|..:.|.|.|        .|
pombe   201 DFPSNNKDGGYRRNNYRDRDSNRYRNSYRPSRP-----QREHSPGNYRKERYNVD--------SR 252

  Fly   480 PRHDRERSAKGSQ----DHRSGRNPRD 502
            ||  |||...|..    :|.|..|.|:
pombe   253 PR--RERHFHGRSFAHAEHHSVPNMRN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Saf-BNP_733041.2 SAP 11..42 CDD:280251
RRM 205..>394 CDD:223796 39/172 (23%)
RRM_SAFB_like 313..386 CDD:240863 23/72 (32%)
SWIRM-assoc_1 <588..618 CDD:293104
SPAC25G10.01NP_001342863.1 RRM 9..>225 CDD:223796 48/218 (22%)
RRM_RBMX_like 100..179 CDD:240828 24/78 (31%)
RRM 207..>283 CDD:330708 20/86 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto101110
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1765
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.