DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Saf-B and rsp-8

DIOPT Version :9

Sequence 1:NP_733041.2 Gene:Saf-B / 42958 FlyBaseID:FBgn0039229 Length:928 Species:Drosophila melanogaster
Sequence 2:NP_001255142.1 Gene:rsp-8 / 176613 WormBaseID:WBGene00004705 Length:309 Species:Caenorhabditis elegans


Alignment Length:309 Identity:74/309 - (23%)
Similarity:115/309 - (37%) Gaps:57/309 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 KSNSKDADKKNDDGARSKKRDEKSGDKKDSSEQKSSGKSSNQKDDKEKSTAAPGGATSSTASSAA 285
            :|||:         ::|:.|:...|..:.:|:.....:...:........|..||          
 Worm     6 RSNSR---------SQSRSRENSRGRSRSASKSPVYHRRERESSRSRSPRARYGG---------- 51

  Fly   286 GSKSGSGSSAGNGTGANS----NNKQATLSRNLWVSGLSTLTRASDLKAIFSKFGKVIGAKVVTN 346
                |.|...|.|.|.|.    .|.|.  |:.|.|..||:.|...||:.:|.:||::....:|.:
 Worm    52 ----GGGGGGGGGRGRNQQYDRENPQP--SKCLGVFNLSSYTTEKDLRDVFGEFGEINKCDLVYD 110

  Fly   347 TRTPGTRCYGYVTMSSSADASRCIENLHRTELHGRIISVERTKNEIGGS------LNSKEGKGKA 405
            ..:..:|.:|::..:...||:...:.|..|:|.|..|.|:.:..:.|.|      :..:.|.|.:
 Worm   111 RPSGNSRGFGFIYFNLIEDATAARDKLCNTDLDGHKIRVDFSLTKRGHSPTPGQYMGDRRGGGSS 175

  Fly   406 PG---DAGNKKKEDDSGKKSGSGKGSSSNSGDDKKGGD--GNGDSKSVGGDL-----KRDGKESN 460
            .|   ..|...:.:|.|.:.|...|.....|....|||  |.|.....|||.     .|.|....
 Worm   176 GGGRFGGGGGDRFNDRGSRGGDRYGGDRRGGGGGGGGDRYGGGGGDRYGGDRYGGGGGRRGSPDR 240

  Fly   461 RARSRRNDDRGKSLAS------QDRPRH-DRERSAKGSQDHRSGRNPRD 502
            |...|.....|..:.|      .||..| |.:|:..|     .|..|.|
 Worm   241 RGGFRSGGGGGGYMRSGGGGGGPDRRDHRDNDRNGGG-----GGHRPYD 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Saf-BNP_733041.2 SAP 11..42 CDD:280251
RRM 205..>394 CDD:223796 40/176 (23%)
RRM_SAFB_like 313..386 CDD:240863 20/72 (28%)
SWIRM-assoc_1 <588..618 CDD:293104
rsp-8NP_001255142.1 RRM_TRA2 77..154 CDD:240809 21/76 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1765
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.