DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and CWC27

DIOPT Version :9

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_015261.1 Gene:CWC27 / 856041 SGDID:S000005985 Length:301 Species:Saccharomyces cerevisiae


Alignment Length:269 Identity:54/269 - (20%)
Similarity:104/269 - (38%) Gaps:66/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VIETTMGDLTVDLFISERPIACLNFLKLC-----------RLKYYNFNLFHTVQQGFIAQTGDPS 57
            ::.||.|::.::|:..|.|..|..||.:.           .||...:.:|:....|         
Yeast    14 ILYTTKGNIAIELWAKECPETCKRFLSMLSDGTFTNGEFKELKPTQWLMFNANSTG--------- 69

  Fly    58 GAGDGGSSIWGVVEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLT-LGENLTSLDG 121
                            :.|....|..|:|..:..|:|     |.:...:.:|:| |.::...|  
Yeast    70 ----------------EYRTVAEEKNPRIRFNRDGLL-----GWDRRRNTWFITVLADSKHVL-- 111

  Fly   122 NHC-VIGEVV-EGHEVLRKLNDAIVDDSFRPYQDIRITHTVVL----------EDPFPNPRGLQA 174
            |.| |.|::| :...:.|::....::.|.|.....|..:..||          ||.|.:.|.|:.
Yeast   112 NDCNVFGKIVGKSIYIFREILGGEIEASSRDNDVKRFMYPAVLKDVEITIPFFEDIFGSKRRLED 176

  Fly   175 PSRSPSPSAERL-KNGRI--AADEDIDDTDGMTAEEMQEMLAEREAKARATILE---IVGDLPDA 233
            ..:.....|::| |:.::  ..:::.:|.||    ::|::...:.....|.|.:   ..|...||
Yeast   177 NEKKEQEPAKKLVKSAKVKMVYEDEQEDDDG----DVQKLKPRKRMILPAWIKDDSRSEGIKLDA 237

  Fly   234 DMAPPENVL 242
            .:..|:..|
Yeast   238 SLDQPQEAL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 38/188 (20%)
RRM <237..445 CDD:223796 2/6 (33%)
RRM_PPIL4 237..319 CDD:240681 2/6 (33%)
CWC27NP_015261.1 cyclophilin 6..167 CDD:412213 36/184 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I1612
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.