DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and AT1G01940

DIOPT Version :10

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_171696.2 Gene:AT1G01940 / 839309 AraportID:AT1G01940 Length:160 Species:Arabidopsis thaliana


Alignment Length:281 Identity:51/281 - (18%)
Similarity:91/281 - (32%) Gaps:97/281 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 EPVDDDEYKVSQSEVESEPATSDDSFSPPNKRKRTPKRRVGRPPGRGRPGRKPKNMVVS------ 326
            :|:||   |.|...:|.:...|.||           :.:.|:......|.:.||..::.      
plant   248 KPLDD---KYSSLLLEDDEMLSQDS-----------ENQSGKSDADKAPWQMPKEQLLQWKRNRR 298

  Fly   327 -------------TPKFAVKRG------------------PGRPP---KYPKTSSLTNI---VYI 354
                         .|:..:|:|                  .|.||   ..|:.:....|   |.:
plant   299 ALAYSTVGTLDYMAPEVLLKKGYGMECDWWSLGAILYEMLVGYPPFCSDDPRITCRKIINWRVCL 363

  Fly   355 EAPEDSSSSGEEAEVTPKRRKRGDNPCPKCDEVLPSQLALK--QHLKTHP---GDRFDCDRCALF 414
            :.||:...|.|..::..:.         .||  :.|:|..:  :.:|:||   |..:|     ..
plant   364 KFPEEPKISDEARDLICRL---------LCD--VDSRLGTRGVEEIKSHPWFKGTPWD-----KL 412

  Fly   415 FRTEKAL---------SNHIERHKKADKIREEK------RKEREQRIEQRSRYTPKSSDAEKSKL 464
            :..|.|.         :.:.|:..:.:....|.      ||....:......:|.|.||..:|. 
plant   413 YDMEAAYRPIVDGELDTQNFEKFPEVEGSPSEAPQVGPWRKMLTSKDTNFIGFTFKKSDITRSM- 476

  Fly   465 ISPQGSATAEKKKKSEPSAAS 485
               :.|.:|:.|......|.|
plant   477 ---ESSGSADMKSNGSGEAPS 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902
RRM_PPIL4 237..319 CDD:409681 11/50 (22%)
PRK12678 344..>510 CDD:237171 31/165 (19%)
U2AF_lg 467..>572 CDD:273727 5/19 (26%)
AT1G01940NP_171696.2 Cyclophilin_PPIL3_like 1..153 CDD:238909
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.