DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and ROC1

DIOPT Version :10

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_195585.1 Gene:ROC1 / 830029 AraportID:AT4G38740 Length:172 Species:Arabidopsis thaliana


Alignment Length:166 Identity:53/166 - (31%)
Similarity:82/166 - (49%) Gaps:27/166 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GDLTVDLFISERPIACLNFLKLC----------RLKYYNFNLFHTVQQGFIAQTGD-PSGAGDGG 63
            |.:.::|:..:.|....||..||          :..::..:.||.|...|:.|.|| .:|.|.||
plant    18 GRIVMELYTDKTPRTAENFRALCTGEKGVGGTGKPLHFKGSKFHRVIPNFMCQGGDFTAGNGTGG 82

  Fly    64 SSIWGVVEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTSLDGNHCVIGE 128
            .||:|      .:|.:..|..|  |:..|:||:.:||.|..|||||:...:. ..|||.|.|.|:
plant    83 ESIYG------SKFEDENFERK--HTGPGILSMANAGANTNGSQFFICTVKT-DWLDGKHVVFGQ 138

  Fly   129 VVEGHEVLRKLNDAIVDDSFRPYQDIRITHTVVLED 164
            ||||.:|::.: :.:...|.:|      |..||:.|
plant   139 VVEGLDVVKAI-EKVGSSSGKP------TKPVVVAD 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 53/166 (32%)
RRM_PPIL4 237..319 CDD:409681
PRK12678 344..>510 CDD:237171
U2AF_lg 467..>572 CDD:273727
ROC1NP_195585.1 cyclophilin_ABH_like 4..169 CDD:238907 53/166 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.