DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and AT4G34960

DIOPT Version :10

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_195222.1 Gene:AT4G34960 / 829648 AraportID:AT4G34960 Length:224 Species:Arabidopsis thaliana


Alignment Length:137 Identity:44/137 - (32%)
Similarity:67/137 - (48%) Gaps:24/137 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MGDLTVDLFISERPIACLNFLKLC----------RLKYYNFNLFHTVQQGFIAQTGD-PSGAGDG 62
            :|.:.:.|:.:..|....||..||          :..:|....||.:..||:.|.|| ..|.|..
plant    60 LGRIVIGLYGTVVPKTVENFRALCTGEKGKTSSGKPLHYKGTPFHRIISGFVIQGGDIIHGDGKS 124

  Fly    63 GSSIWGVVEG--PQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTSLDGNHCV 125
            ..||:|   |  |.:.|       ||.||.|||:::.:.|.:..|||||:|. ...:.|:|.|.|
plant   125 SDSIYG---GTFPDENF-------KIQHSHAGMVAMANTGPDSNGSQFFITT-VKASWLEGEHVV 178

  Fly   126 IGEVVEG 132
            :|:|::|
plant   179 LGKVIQG 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 44/137 (32%)
RRM_PPIL4 237..319 CDD:409681
PRK12678 344..>510 CDD:237171
U2AF_lg 467..>572 CDD:273727
AT4G34960NP_195222.1 cyclophilin 48..213 CDD:469651 44/137 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.