DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and CYP5

DIOPT Version :10

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_180557.1 Gene:CYP5 / 817546 AraportID:AT2G29960 Length:201 Species:Arabidopsis thaliana


Alignment Length:143 Identity:48/143 - (33%)
Similarity:75/143 - (52%) Gaps:24/143 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GDLTVDLFISERPIACLNFLKLC----------RLKYYNFNLFHTVQQGFIAQTGD-PSGAGDGG 63
            |.:.:.||....|....||..||          :..:|..:.||.:...|:.|.|| ..|.|.||
plant    46 GRVVIGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHYKGSKFHRIIPSFMIQGGDFTHGNGMGG 110

  Fly    64 SSIWGVVEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTS--LDGNHCVI 126
            .||:|      ::|.:..|  |:.|:..|:||:.::|::..|||||:|   .:|:  |||.|.|.
plant   111 ESIYG------QKFADENF--KLKHTGPGVLSMANSGEDTNGSQFFIT---TVTTSWLDGRHVVF 164

  Fly   127 GEVVEGHEVLRKL 139
            |:||:|.:|:.|:
plant   165 GKVVQGMDVVYKI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 48/143 (34%)
RRM_PPIL4 237..319 CDD:409681
PRK12678 344..>510 CDD:237171
U2AF_lg 467..>572 CDD:273727
CYP5NP_180557.1 cyclophilin_ABH_like 32..197 CDD:238907 48/143 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.