DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and ROC3

DIOPT Version :10

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_001318231.1 Gene:ROC3 / 816161 AraportID:AT2G16600 Length:173 Species:Arabidopsis thaliana


Alignment Length:158 Identity:54/158 - (34%)
Similarity:80/158 - (50%) Gaps:21/158 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GDLTVDLFISERPIACLNFLKLC----------RLKYYNFNLFHTVQQGFIAQTGD-PSGAGDGG 63
            |.:.::|:....|....||..||          :..:|..:.||.|...|:.|.|| .:|.|.||
plant    19 GRIVMELYADTTPETAENFRALCTGERGIGKQGKPLHYKGSSFHRVIPKFMCQGGDFTAGNGTGG 83

  Fly    64 SSIWGVVEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTSLDGNHCVIGE 128
            .||:|      .:|.:..|:.|  |:..|:||:.:||.|..|||||:.. |..:.|||.|.|.|:
plant    84 ESIYG------SKFKDENFIKK--HTGPGILSMANAGANTNGSQFFICT-EKTSWLDGKHVVFGQ 139

  Fly   129 VVEGHEVLRKLNDAIVDDSFRPYQDIRI 156
            ||||..|:|.: :.:..||.|..:.:.|
plant   140 VVEGLNVVRDI-EKVGSDSGRTSKPVVI 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 54/158 (34%)
RRM_PPIL4 237..319 CDD:409681
PRK12678 344..>510 CDD:237171
U2AF_lg 467..>572 CDD:273727
ROC3NP_001318231.1 cyclophilin_ABH_like 5..170 CDD:238907 54/158 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.