DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and Ppil1

DIOPT Version :9

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_081121.1 Gene:Ppil1 / 68816 MGIID:1916066 Length:166 Species:Mus musculus


Alignment Length:155 Identity:56/155 - (36%)
Similarity:88/155 - (56%) Gaps:8/155 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SVVIETTMGDLTVDLFISERPIACLNFLKLCRLKYYNFNLFHTVQQGFIAQTGDPSGAGDGGSSI 66
            :|.:||:||.:.::|:....|..|.||.:|.|..|||...||.:.:.|:.|.|||:|.|.||:||
Mouse    13 NVYLETSMGVIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASI 77

  Fly    67 WGVVEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTSLDGNHCVIGEVVE 131
            :|       :.||.|..|.:..:.||:|::.:||.:..|||||:||... ..|||.|.:.|.|.:
Mouse    78 YG-------KQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPT-QWLDGKHTIFGRVCQ 134

  Fly   132 GHEVLRKLNDAIVDDSFRPYQDIRI 156
            |..::.::.....:...||..|::|
Mouse   135 GIGMVNRVGMVETNSQDRPVDDVKI 159

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 55/153 (36%)
RRM <237..445 CDD:223796
RRM_PPIL4 237..319 CDD:240681
Ppil1NP_081121.1 cyclophilin_SpCYP2_like 15..161 CDD:238903 55/153 (36%)
Cyclosporin A binding. /evidence=ECO:0000250 54..65 3/10 (30%)