DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and PPIAL4C

DIOPT Version :9

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_001129261.2 Gene:PPIAL4C / 653598 HGNCID:33995 Length:164 Species:Homo sapiens


Alignment Length:129 Identity:43/129 - (33%)
Similarity:66/129 - (51%) Gaps:17/129 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MGDLTVDLFISERPIACLNFLKLCRLK---YYNFNLFHTVQQGFIAQTGD---PSGAGDGGSSIW 67
            :|.:::.||..:.|....||..|...:   .|..:.||.:..||:.|.||   |:|.||  .||:
Human    17 LGRISIKLFADKIPKTAENFRALSTGEKGFRYKGSCFHRIIPGFMCQGGDFTRPNGTGD--KSIY 79

  Fly    68 GVVEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTSLDGNHCVIGEVVE 131
            |      ::|.:...:.|  |:.:|:||:.:||.|..|||||:...:. ..|||.|...|:|.|
Human    80 G------EKFDDENLIRK--HTGSGILSMANAGPNTNGSQFFICTAKT-EWLDGKHVAFGKVKE 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 43/129 (33%)
RRM <237..445 CDD:223796
RRM_PPIL4 237..319 CDD:240681
PPIAL4CNP_001129261.2 cyclophilin 4..162 CDD:320812 43/129 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.