DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and PPIAL4G

DIOPT Version :10

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_001116540.1 Gene:PPIAL4G / 644591 HGNCID:33996 Length:164 Species:Homo sapiens


Alignment Length:129 Identity:42/129 - (32%)
Similarity:65/129 - (50%) Gaps:17/129 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MGDLTVDLFISERPIACLNFLKLCRLK---YYNFNLFHTVQQGFIAQTGD---PSGAGDGGSSIW 67
            :|.:::..|..:.|....||..|...:   .|..:.||.:..||:.|.||   |:|.||  .||:
Human    17 LGRISIKQFADKIPKTAENFRALSTGEKGFRYKGSCFHRIIPGFMCQGGDFTHPNGTGD--KSIY 79

  Fly    68 GVVEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTSLDGNHCVIGEVVE 131
            |      ::|.:...:.|  |:.:|:||:.:||.|..|||||:...:. ..|||.|...|:|.|
Human    80 G------EKFDDENLIRK--HTGSGILSMANAGPNTNGSQFFICTAKT-EWLDGKHVAFGKVKE 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 42/129 (33%)
RRM_PPIL4 237..319 CDD:409681
PRK12678 344..>510 CDD:237171
U2AF_lg 467..>572 CDD:273727
PPIAL4GNP_001116540.1 cyclophilin 4..162 CDD:469651 42/129 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.