DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and ZC250.5

DIOPT Version :10

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_001123073.1 Gene:ZC250.5 / 6418817 WormBaseID:WBGene00045306 Length:204 Species:Caenorhabditis elegans


Alignment Length:87 Identity:24/87 - (27%)
Similarity:44/87 - (50%) Gaps:5/87 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 QKRFFEAEFLPKINHSSAGMLSLVS-AGKNLVGSQFFLTLGENLTS-LDGNHCVIGEVVEGHEVL 136
            :|.|.|..|...:.::...::.|.| ....:..|.|::.|.::..| :||  |.||:|:||.|:|
 Worm   116 RKLFQENNFSSTVQNTRGKVILLPSDTNPTVFSSLFYVLLDKSGPSVVDG--CPIGDVIEGIEIL 178

  Fly   137 RKLNDAIVDDSFRPYQDIRITH 158
            ..:......::.||.:.: |.|
 Worm   179 ETIVKEYGSENGRPGKKL-IVH 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 24/87 (28%)
RRM_PPIL4 237..319 CDD:409681
PRK12678 344..>510 CDD:237171
U2AF_lg 467..>572 CDD:273727
ZC250.5NP_001123073.1 cyclophilin 29..204 CDD:469651 24/87 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.