DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and ppifb

DIOPT Version :9

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_001032199.2 Gene:ppifb / 641328 ZFINID:ZDB-GENE-051030-126 Length:192 Species:Danio rerio


Alignment Length:153 Identity:57/153 - (37%)
Similarity:80/153 - (52%) Gaps:14/153 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MGDLTVDLFISERPIACLNFLKLCRLKY---YNFNLFHTVQQGFIAQTGD-PSGAGDGGSSIWGV 69
            :|.:|.:|.....|....||..||..::   |..::||.|...|:.|.|| .:..|.||.||:| 
Zfish    44 LGRVTFELNADVVPKTAENFRALCTGEHGFGYKGSIFHRVIPQFMCQGGDFTNHNGTGGKSIYG- 107

  Fly    70 VEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTSLDGNHCVIGEVVEGHE 134
                 .||.:..|  |:.|:..|:||:.:||.|..|||||:...:. ..|||.|.|.|.|.||.:
Zfish   108 -----PRFPDENF--KLKHTGPGILSMANAGVNTNGSQFFICTAKT-EWLDGRHVVFGSVKEGMD 164

  Fly   135 VLRKLNDAIVDDSFRPYQDIRIT 157
            |:||: :|:...|.|..|.|.||
Zfish   165 VVRKV-EALGSRSGRTAQRISIT 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 57/153 (37%)
RRM <237..445 CDD:223796
RRM_PPIL4 237..319 CDD:240681
ppifbNP_001032199.2 cyclophilin_ABH_like 31..189 CDD:238907 57/153 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.