DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and T22F3.12

DIOPT Version :9

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_001041170.1 Gene:T22F3.12 / 4363086 WormBaseID:WBGene00044705 Length:174 Species:Caenorhabditis elegans


Alignment Length:143 Identity:46/143 - (32%)
Similarity:70/143 - (48%) Gaps:21/143 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MGDLTVDLFISERPIACLNFLKLCR----LKYYNFNLFHTVQQGFIAQTGD---PSGAGDGGSSI 66
            :|.|..:|...:.|..|.||:|||.    ..|.|. :|:.|...|.|.:||   .:...|||.|.
 Worm    16 LGKLVFELNTEKCPKTCENFVKLCTGPPGFGYKNC-VFYRVIPTFCACSGDFETQNARRDGGKST 79

  Fly    67 WGVVEGPQKRFFEAEFLPKINHSSAGMLSLVSAG-KNLVGSQFFLTLGENLTSLDGNHCVIGEVV 130
            :|.      ::|:.|.. :|.|...|:|.:.:.| :|...|:|::|..|. ..::..|...||:|
 Worm    80 FGT------KYFDDENF-EILHDKKGILGMDNYGWENTNSSRFYVTFRET-PWMNRFHVAFGELV 136

  Fly   131 EGHEVLRKLNDAI 143
            ||.:||    |||
 Worm   137 EGFDVL----DAI 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 46/143 (32%)
RRM <237..445 CDD:223796
RRM_PPIL4 237..319 CDD:240681
T22F3.12NP_001041170.1 cyclophilin 4..171 CDD:294131 46/143 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.