DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and ppib

DIOPT Version :9

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_998184.1 Gene:ppib / 406292 ZFINID:ZDB-GENE-040426-1955 Length:216 Species:Danio rerio


Alignment Length:163 Identity:58/163 - (35%)
Similarity:85/163 - (52%) Gaps:15/163 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GDLTVDLFISERPIACLNFLKLCRLKY---YNFNLFHTVQQGFIAQTGD-PSGAGDGGSSIWGVV 70
            |.:.:.||....|....|||:|...:.   |..:.||.|.:.|:.|.|| ..|.|.||.||:|  
Zfish    58 GRIVIGLFGKTVPKTTENFLQLATGEKGFGYKGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYG-- 120

  Fly    71 EGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTSLDGNHCVIGEVVEGHEV 135
                .||.:..|  |:.|...|.||:.:|||:..|||||:|..:. ..|||.|.|.|:::||.:|
Zfish   121 ----DRFPDENF--KLKHYGPGWLSMANAGKDTNGSQFFITTVQT-PWLDGKHVVFGKILEGMDV 178

  Fly   136 LRKLNDAIVDDSFRPYQDIRI--THTVVLEDPF 166
            :||:.....|...:|.:|:.|  :..:.:|.||
Zfish   179 VRKIEATKTDGRDKPLKDVSIHDSGKIDVEKPF 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 58/163 (36%)
RRM <237..445 CDD:223796
RRM_PPIL4 237..319 CDD:240681
ppibNP_998184.1 cyclophilin_ABH_like 45..203 CDD:238907 55/153 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.