DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and CG7768

DIOPT Version :9

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster


Alignment Length:160 Identity:55/160 - (34%)
Similarity:86/160 - (53%) Gaps:20/160 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MGDLTVDLFISERPIACLNFLKLCR-LKYYNF--NLFHTVQQGFIAQTGD-PSGAGDGGSSIWGV 69
            :|.:.::|.....|....||..||. .|.|.:  :.||.|...|:.|.|| .:..|.||.||:| 
  Fly    17 LGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFTNQNGTGGRSIYG- 80

  Fly    70 VEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTSLDGNHCVIGEVVEGHE 134
                 .:|.:..|  ::.|:.||:||:.:||.|..|||||:..|:. |.||..|.|.|:||||.:
  Fly    81 -----NKFPDENF--ELKHTGAGVLSMANAGANTNGSQFFICTGKT-TWLDNKHVVFGKVVEGMD 137

  Fly   135 VLRKLNDAIVDDSFRPYQDIRITHTVVLED 164
            :::|:      :|:.. ||.:.:..|::||
  Fly   138 IVQKV------ESYGS-QDGKTSKKVIIED 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 55/160 (34%)
RRM <237..445 CDD:223796
RRM_PPIL4 237..319 CDD:240681
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 55/160 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447240
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.