DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and CG8336

DIOPT Version :9

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster


Alignment Length:449 Identity:97/449 - (21%)
Similarity:165/449 - (36%) Gaps:125/449 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GDLTVDLFISERPIACLNFLKLC----------RLKYYNFNLFHTVQQGFIAQTGD-PSGAGDGG 63
            |.:.::|.....|....||..||          :..:|....||.:::.|:.|:|| ....|..|
  Fly    29 GRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRVFVVQSGDVVKNDGSSG 93

  Fly    64 SSIWGVVEGPQKRFFEAEFLPKINHSSAGMLSLVSAGK-NLVGSQFFLTLG--ENLTSLDGNHCV 125
            .||:|.|      |.:..|  :::|:..|::|:.:.|| |...||||::..  ||   |:|.:.|
  Fly    94 ESIYGPV------FDDENF--ELSHNEEGVVSMANYGKPNSNNSQFFISAAGCEN---LNGTNVV 147

  Fly   126 IGEVVEGHEVLRKLNDAIVDDSFRPYQDIRITHTVVLEDPFPNPRGLQAPSRSPSPSAERLKNGR 190
            :|.|:.|..::.::.....|:. .|      |..:|:.|                       .|.
  Fly   148 VGRVLRGLGIVAEMEQNCTDEG-DP------TAPIVIRD-----------------------CGE 182

  Fly   191 IAADED--IDDTDGMTAEEMQEMLAEREAKARATILEIVGDLPDADMAPPENVLFVCKLNPVTTD 253
            ||.:||  |:..|                       |....||    |.|::  :..||:..|.|
  Fly   183 IAHNEDWGIECND-----------------------ETTDKLP----AYPQD--WPRKLDKFTGD 218

  Fly   254 DDLEIIFSSFGVLKGCEVIRDRKTGDSLQYAFVEFEDQKSCEAAYFKMDNVLIDDRRIHVDFSQS 318
            ..:|::   .|:         |::|:.    |.:........|.|.|.      :|..|....| 
  Fly   219 GAVELL---TGI---------RQSGNH----FYQLGRYHEARAKYRKA------NRYYHYLSRQ- 260

  Fly   319 VSKVTWRG----KGRGIEGDYRKLD----FNNLRDDKDHRKPNNGRSRTEDHKERNRTEDFRNRM 375
               ..|:.    |...::.|..|:|    .||:.......|..|..|..|...|..|.:.   :.
  Fly   261 ---FGWQQLNPLKKHLVDEDLLKVDGFSVVNNINAAAVDLKVGNYTSAREVCNEAIRLDP---KC 319

  Fly   376 SSAERRKAREQRHQEQSERDVRKNLQRRTRSKEKDEKSVYRSKKSQNESVRENSNRERN 434
            |.|..|:|:.||.....|..:  |..:...:...:.|.:.....|..:.:.:.:.::||
  Fly   320 SKAFYRRAQAQRGLRNYEEAI--NDLKTAHNLLPENKQILNELNSTKQLLAQYNRQQRN 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 45/172 (26%)
RRM <237..445 CDD:223796 41/206 (20%)
RRM_PPIL4 237..319 CDD:240681 16/81 (20%)
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 45/192 (23%)
TPR repeat 285..315 CDD:276809 7/29 (24%)
TPR_19 300..369 CDD:291240 15/73 (21%)
TPR_1 320..353 CDD:278916 8/34 (24%)
TPR repeat 320..346 CDD:276809 8/27 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447200
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.