DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and RBMY1E

DIOPT Version :9

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_001006118.2 Gene:RBMY1E / 378950 HGNCID:23916 Length:496 Species:Homo sapiens


Alignment Length:430 Identity:102/430 - (23%)
Similarity:147/430 - (34%) Gaps:103/430 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 LFVCKLNPVTTDDDLEIIFSSFGVLKGCEVIRDRKTGDSLQYAFVEFEDQKSCEAAYFKMDNVLI 306
            ||:..||..|.:..|:.:|...|.:....:|:|| |..|..:||:.||:....:.|...|:...:
Human    10 LFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDR-TSKSRGFAFITFENPADAKNAAKDMNGKSL 73

  Fly   307 DDRRIHVDFSQSVSKVTWRGKGRGIEGDYRKLDFNNLRDDKDHRKPNNGRSRTEDHKERNRTEDF 371
            ..:.|.|   :...|.:::..||                    |:|               ....
Human    74 HGKAIKV---EQAKKPSFQSGGR--------------------RRP---------------PASS 100

  Fly   372 RNRMSSAERRKAREQR------------HQEQS--ERDVRKNLQRRTRSKEKDEKSVYRS----- 417
            |||..|...|.||..|            |.:..  ..|::.:..|.....::...|  ||     
Human   101 RNRSPSGSLRSARGSRGGTRGWLPSQEGHLDDGGYTPDLKMSYSRGLIPVKRGPSS--RSGGPPP 163

  Fly   418 KKSQNESV-REN---------SNRERN-------------RNEKRSSR-----SRDATHRRYSRS 454
            |||...:| |.|         |.|..|             ||::.|:|     :.|..|.....:
Human   164 KKSAPSAVARSNSWMGSQGPMSQRRENYGVPPRRATISSWRNDRMSTRHDGYATNDGNHPSCQET 228

  Fly   455 RDREERRPSRPRDQLGRRSRSRDQKERRRSRPREQNERRRSRSRDQT-GKRPTQNRDRNDSRRFH 518
            ||...  |||..........:||:...|..|    |.|....:||.. ..|....||...|||..
Human   229 RDYAP--PSRGYAYRDNGHSNRDEHSSRGYR----NHRSSRETRDYAPPSRGHAYRDYGHSRRDE 287

  Fly   519 SPQEGRRNDERSHRETSRNQRRSPERRQQSRN-REDHRMDTHSSPNKSHEKKRKLSVEKSKKQAK 582
            |...|.|| .||.|||  .:...|.|....|: ....|.:::|...::|...|:........:..
Human   288 SYSRGYRN-RRSSRET--REYAPPSRGHGYRDYGHSRRHESYSRGYRNHPSSRETRDYAPPHRDY 349

  Fly   583 KSKRAASSSSDSSESSSESESD----STSSDSSEDSSSSS 618
            ..:....||.|...|...|..|    :...|.||..|.||
Human   350 AYRDYGHSSWDEHSSRGYSYHDGYGEALGRDHSEHLSGSS 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902
RRM <237..445 CDD:223796 53/249 (21%)
RRM_PPIL4 237..319 CDD:240681 21/76 (28%)
RBMY1ENP_001006118.2 RRM <1..189 CDD:223796 48/219 (22%)
RRM_RBMX_like 7..85 CDD:240828 21/78 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..348 72/329 (22%)
RBM1CTR 174..218 CDD:285341 8/43 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 453..496
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.