DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and CG2852

DIOPT Version :10

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster


Alignment Length:159 Identity:58/159 - (36%)
Similarity:86/159 - (54%) Gaps:17/159 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GDLTVDLFISERPIACLNFLKLCRLK----YYNFNLFHTVQQGFIAQTGD-PSGAGDGGSSIWGV 69
            |.:.:.||....|....||.:|. ||    .|..:.||.:.:.|:.|.|| ..|.|.||.||:| 
  Fly    43 GRIEIGLFGKTVPKTVENFKELA-LKPQGEGYKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYG- 105

  Fly    70 VEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTS-LDGNHCVIGEVVEGH 133
                 :||.:..|  |:.|..||.||:.:|||:..|||||:|..:  || |||.|.|.|:::.|.
  Fly   106 -----ERFEDENF--KLKHYGAGWLSMANAGKDTNGSQFFITTKQ--TSWLDGRHVVFGKILSGM 161

  Fly   134 EVLRKLNDAIVDDSFRPYQDIRITHTVVL 162
            .|:|::.::..|...||.:|:.|.::..|
  Fly   162 NVVRQIENSATDARDRPVKDVVIANSGTL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 58/159 (36%)
RRM_PPIL4 237..319 CDD:409681
PRK12678 344..>510 CDD:237171
U2AF_lg 467..>572 CDD:273727
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 57/155 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.