DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and CG7747

DIOPT Version :9

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster


Alignment Length:241 Identity:85/241 - (35%)
Similarity:126/241 - (52%) Gaps:34/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VVIETTMGDLTVDLFISERPIACLNFLKLCRLKYYNFNLFHTVQQGFIAQTGDPSGAGDGGSSIW 67
            |.:.|.:|.|.::||..:.|.||.||:|.|...|||..:||...:.||.|.|||:|:|.||.|||
  Fly   282 VRLNTNLGPLNLELFCDQTPRACDNFIKHCANGYYNNVMFHRSIRNFIVQGGDPTGSGSGGESIW 346

  Fly    68 GVVEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTSLDGNHCVIGEVVEG 132
            |       :.||.||.|.:.|:..|:||:.::|.|..|||||:|. .:...|||.|.:.|::|.|
  Fly   347 G-------KKFEDEFKPNLTHTGRGVLSMANSGPNTNGSQFFITY-RSCKHLDGKHTIFGKLVGG 403

  Fly   133 HEVLRKLNDAIVDDSFRPYQDIRITHTVVLEDPFPNPRGLQAPSRSPSPSAERLKNGR---IAAD 194
            .:.|:|:.:..||:..||.:||.|..:.|..:||             :.:||:|...|   .|..
  Fly   404 LDTLQKMENIEVDNKDRPIEDIIIESSQVFVNPF-------------AEAAEQLAKEREEEAAGK 455

  Fly   195 EDIDDTDGMTAEEMQEMLAE-----REAKARATILEIVGDLPDADM 235
            |:|     :..||.|:.:.|     ||...:...|:.|...|:|.:
  Fly   456 EEI-----VKKEEQQKRMKEPLKVYREGVGKYLKLQTVAKKPEAPL 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 67/164 (41%)
RRM <237..445 CDD:223796
RRM_PPIL4 237..319 CDD:240681
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 68/177 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447184
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.