DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and Ppih

DIOPT Version :9

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:XP_003750067.2 Gene:Ppih / 366461 RGDID:1564921 Length:177 Species:Rattus norvegicus


Alignment Length:151 Identity:47/151 - (31%)
Similarity:79/151 - (52%) Gaps:18/151 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MGDLTVDLFISERPIACLNFLKLCRLKY--------YNFNLFHTVQQGFIAQTGD-PSGAGDGGS 64
            :|.:.::||....|....||.:.|..::        |..:.||.|.:.|:.|.|| .:|.|.|.:
  Rat    24 VGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVA 88

  Fly    65 SIWGVVEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTSLDGNHCVIGEV 129
            ||:   .||   |.:..|  |:.||:.|:||:.::|.:..|.|||:|..: ...|||.|.|.|::
  Rat    89 SIY---RGP---FADENF--KLRHSAPGLLSMANSGPSTNGCQFFITCSK-CDWLDGKHVVFGKI 144

  Fly   130 VEGHEVLRKLNDAIVDDSFRP 150
            ::|..|:||:.:.....:.:|
  Rat   145 IDGLLVMRKIENVPTGPNNKP 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 47/151 (31%)
RRM <237..445 CDD:223796
RRM_PPIL4 237..319 CDD:240681
PpihXP_003750067.2 cyclophilin 8..177 CDD:412213 47/151 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.