DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and Ppial4g

DIOPT Version :10

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:XP_341364.2 Gene:Ppial4g / 361080 RGDID:1559682 Length:195 Species:Rattus norvegicus


Alignment Length:136 Identity:42/136 - (30%)
Similarity:66/136 - (48%) Gaps:19/136 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MGDLTVDLFISERPIACLNFLKLCRLKY---YNFNLFHTVQQGFIAQTGDPS-GAGDGGSSIWGV 69
            :|.::::||..:.|....||..|...:.   |..:.||.:..||:.|.|..: ..|.||.||:| 
  Rat    17 LGRVSLELFADKVPRTAENFRSLTTGEKGFGYKGSSFHRIIPGFMCQGGKVTCHNGTGGKSIYG- 80

  Fly    70 VEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTSLDGNHCVIGE------ 128
                 ::|....|:  :.|:..|:||:.:||.|..|||||:...:. ..|||...|.|:      
  Rat    81 -----EKFENDSFI--LKHTGPGILSMANAGPNTNGSQFFICTAKT-ERLDGKCVVFGKGRGGTN 137

  Fly   129 VVEGHE 134
            :||..|
  Rat   138 IVEAME 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 42/136 (31%)
RRM_PPIL4 237..319 CDD:409681
PRK12678 344..>510 CDD:237171
U2AF_lg 467..>572 CDD:273727
Ppial4gXP_341364.2 cyclophilin 7..162 CDD:469651 42/136 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.