DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and CG11777

DIOPT Version :9

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster


Alignment Length:166 Identity:64/166 - (38%)
Similarity:92/166 - (55%) Gaps:9/166 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVVIETTMGDLTVDLFISERPIACLNFLKLCRLKYYNFNLFHTVQQGFIAQTGDPSGAGDGGSS 65
            |||.:.|.:|||.::||....|.||.|||.||...||:..:|....:|||.|||||:..|..|.|
  Fly     1 MSVTLHTDVGDLKIELFCDACPKACENFLALCASDYYSGCVFIRNIKGFIVQTGDPTNTGKNGQS 65

  Fly    66 IWGVVEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTSLDGNHCVIGEVV 130
            |||     ||  |:.||...|.|:..||:|:.:.|.|...||||:|.... .:||..:.:.|.|:
  Fly    66 IWG-----QK--FDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQ-PNLDLKYTLFGRVI 122

  Fly   131 EGHEVLRKLNDAIVD-DSFRPYQDIRITHTVVLEDP 165
            :|.:.|.:|....|: .::||:.|.:|....:..:|
  Fly   123 DGFDALDELEKLPVNPKNYRPHVDKKINGVTIHANP 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 61/163 (37%)
RRM <237..445 CDD:223796
RRM_PPIL4 237..319 CDD:240681
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 63/160 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447209
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.