DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and Ppil2

DIOPT Version :9

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_001017383.1 Gene:Ppil2 / 360746 RGDID:1309484 Length:521 Species:Rattus norvegicus


Alignment Length:221 Identity:68/221 - (30%)
Similarity:106/221 - (47%) Gaps:42/221 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VVIETTMGDLTVDLFISERPIACLNFLKLCRLKYYNFNLFHTVQQGFIAQTGDPSGAGDGGSSIW 67
            |.:.|..|||.::|.....|..|.||:|||:.:||:..:||...:.|:.|.|||:|.|.||.|.|
  Rat   282 VRLHTNKGDLNLELHCDLTPKTCENFIKLCKKQYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYW 346

  Fly    68 GVVEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTSLDGNHCVIGEVVEG 132
            |       :.|:.||.|.::|:..|:||:.::|.|...||||:|. .:...||..|.:.|.||.|
  Rat   347 G-------KPFKDEFRPNLSHTGRGVLSMANSGPNTNKSQFFITF-RSCAYLDKKHTIFGRVVGG 403

  Fly   133 HEVLRKLNDAIVD-DSFRPYQDIRITHTVVLEDPFPNPRGLQAPSRSPSPSAERLKNGRIAADED 196
            .:.|..:.:...| .:.||.:::||..|.|..||:                              
  Rat   404 FDTLTAMENVESDPKTDRPKEEVRICTTTVFVDPY------------------------------ 438

  Fly   197 IDDTDGMTAEEMQ--EMLAEREAKAR 220
             ::.|...|:|.:  :...:.||||:
  Rat   439 -EEADAQIAQERKKTQHQVDPEAKAK 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 60/165 (36%)
RRM <237..445 CDD:223796
RRM_PPIL4 237..319 CDD:240681
Ppil2NP_001017383.1 Ubox 42..96 CDD:128780
cyclophilin_RING 281..440 CDD:238904 61/196 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.