DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5808 and ppiaa

DIOPT Version :9

Sequence 1:	NP_651291.1	Gene:	CG5808 / 42957	FlyBaseID:	FBgn0027617	Length:	653	Species:	Drosophila melanogaster
Sequence 2:	NP_997923.1	Gene:	ppiaa / 336612	ZFINID:	ZDB-GENE-030131-8556	Length:	164	Species:	Danio rerio

Alignment Length:	136	Identity:	53/136 - (38%)
Similarity:	75/136 - (55%)	Gaps:	15/136 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly     9 MGDLTVDLFISERPIACLNFLKLC--RLKY-YNFNLFHTVQQGFIAQTGD-PSGAGDGGSSIWGV 69
            :|.:.::|.....|....||.:||  :..| |..:.||.|..||:.|.|| .:..|.||.||:|
Zfish    17 VGRVVMELRADVVPRTAENFRQLCTGQPGYGYKGSSFHRVIPGFMCQGGDFTNHNGTGGKSIYG- 80

  Fly    70 VEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTS-LDGNHCVIGEVVEGH 133
                 .:|.:..|  .:.|:.||.||:.:||.|..|||||:...  ||| |||.|.|.|:||||.
Zfish    81 -----NKFADENF--NLKHTGAGCLSMANAGPNTNGSQFFICTA--LTSWLDGKHVVFGQVVEGL 136

  Fly   134 EVLRKL 139
            :|::|:
Zfish   137 DVIKKV 142

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5808	NP_651291.1	cyclophilin_RRM	4..169	CDD:238902	53/136 (39%)
		RRM	<237..445	CDD:223796
		RRM_PPIL4	237..319	CDD:240681
ppiaa	NP_997923.1	cyclophilin_ABH_like	4..162	CDD:238907	53/136 (39%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0652
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900