DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and Ppwd1

DIOPT Version :10

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_001099876.1 Gene:Ppwd1 / 294711 RGDID:1310204 Length:646 Species:Rattus norvegicus


Alignment Length:161 Identity:64/161 - (39%)
Similarity:92/161 - (57%) Gaps:9/161 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SVVIETTMGDLTVDLFISERPIACLNFLKLCRLKYYNFNLFHTVQQGFIAQTGDPSGAGDGGSSI 66
            |.::.|:|||:.:.||..|.|....||....|..|||.:.||.:.:||:.|||||:|.|.||.||
  Rat   493 SAIVHTSMGDIHIKLFPVECPKTVENFCVHSRNGYYNGHTFHRIIKGFMIQTGDPTGTGMGGESI 557

  Fly    67 WGVVEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTSLDGNHCVIGEVVE 131
            ||   |.    ||.||...:.|.....||:.:||.|..|||||:|:... ..||..|.|.|.|.:
  Rat   558 WG---GE----FEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVPT-PWLDNKHTVFGRVTK 614

  Fly   132 GHEVLRKLNDAIVD-DSFRPYQDIRITHTVV 161
            |.||::::::..|: .:.:||:|:.|.:..|
  Rat   615 GMEVVQRISNVKVNPKTDKPYEDVSIINITV 645

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 63/159 (40%)
RRM_PPIL4 237..319 CDD:409681
PRK12678 344..>510 CDD:237171
U2AF_lg 467..>572 CDD:273727
Ppwd1NP_001099876.1 WD40 <89..319 CDD:441893
WD40 repeat 136..177 CDD:293791
WD40 repeat 191..219 CDD:293791
WD40 repeat 226..277 CDD:293791
WD40 repeat 283..326 CDD:293791
cyclophilin_WD40 495..643 CDD:238908 62/155 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.