Sequence 1: | NP_651291.1 | Gene: | CG5808 / 42957 | FlyBaseID: | FBgn0027617 | Length: | 653 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038954525.1 | Gene: | Ranbp2 / 294429 | RGDID: | 1560047 | Length: | 3114 | Species: | Rattus norvegicus |
Alignment Length: | 135 | Identity: | 47/135 - (34%) |
---|---|---|---|
Similarity: | 70/135 - (51%) | Gaps: | 13/135 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 MGDLTVDLFISERPIACLNFLKLCR-LKYYNF--NLFHTVQQGFIAQTGD-PSGAGDGGSSIWGV 69
Fly 70 VEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTSLDGNHCVIGEVVEGHE 134
Fly 135 VLRKL 139 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0652 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |