Sequence 1: | NP_651291.1 | Gene: | CG5808 / 42957 | FlyBaseID: | FBgn0027617 | Length: | 653 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001104768.2 | Gene: | PPIL6 / 285755 | HGNCID: | 21557 | Length: | 337 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 61/198 - (30%) |
---|---|---|---|
Similarity: | 96/198 - (48%) | Gaps: | 39/198 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSVVIETT-MGDLTVDLFISERPIACLNFLKLC-----------RLKYYNFNLFH-TVQQGFIAQ 52
Fly 53 TGD-PSGAGDGGSSI--------WGVVEGPQKRFFEAEFLPKIN----------HSSAGMLSLVS 98
Fly 99 AGKNLVGSQFFLTLGENLTSLDGNHCVIGEVVEGHEVLRKLNDAIVDDSFRPYQDIRITHTVVLE 163
Fly 164 DPF 166 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5808 | NP_651291.1 | cyclophilin_RRM | 4..169 | CDD:238902 | 61/195 (31%) |
RRM | <237..445 | CDD:223796 | |||
RRM_PPIL4 | 237..319 | CDD:240681 | |||
PPIL6 | NP_001104768.2 | cyclophilin | 144..333 | CDD:412213 | 59/193 (31%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0652 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |