DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and Ppif

DIOPT Version :9

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_758443.1 Gene:Ppif / 282819 RGDID:628670 Length:206 Species:Rattus norvegicus


Alignment Length:136 Identity:48/136 - (35%)
Similarity:69/136 - (50%) Gaps:15/136 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MGDLTVDLFISERPIACLNFLKLCRLKY---YNFNLFHTVQQGFIAQTGD-PSGAGDGGSSIWGV 69
            :|.:.::|.....|....||..||..:.   |..:.||.|...|:.|.|| .:..|.||.||:| 
  Rat    58 LGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPAFMCQAGDFTNHNGTGGKSIYG- 121

  Fly    70 VEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFL-TLGENLTSLDGNHCVIGEVVEGH 133
                 .||.:..|  .:.|...|:||:.:||.|..|||||: |:..:.  |||.|.|.|.|.||.
  Rat   122 -----SRFPDENF--TLKHVGPGVLSMANAGPNTNGSQFFICTIKTDW--LDGKHVVFGHVKEGM 177

  Fly   134 EVLRKL 139
            :|::|:
  Rat   178 DVVKKI 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 48/136 (35%)
RRM <237..445 CDD:223796
RRM_PPIL4 237..319 CDD:240681
PpifNP_758443.1 cyclophilin_ABH_like 45..203 CDD:238907 48/136 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.