DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and Ppia

DIOPT Version :10

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_032933.1 Gene:Ppia / 268373 MGIID:97749 Length:164 Species:Mus musculus


Alignment Length:135 Identity:44/135 - (32%)
Similarity:69/135 - (51%) Gaps:13/135 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MGDLTVDLFISERPIACLNFLKLCRLKY---YNFNLFHTVQQGFIAQTGD-PSGAGDGGSSIWGV 69
            :|.::.:||..:.|....||..|...:.   |..:.||.:..||:.|.|| ....|.||.||:| 
Mouse    17 LGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYG- 80

  Fly    70 VEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTSLDGNHCVIGEVVEGHE 134
                 ::|.:..|:  :.|:..|:||:.:||.|..|||||:...:. ..|||.|.|.|:|.||..
Mouse    81 -----EKFEDENFI--LKHTGPGILSMANAGPNTNGSQFFICTAKT-EWLDGKHVVFGKVKEGMN 137

  Fly   135 VLRKL 139
            ::..:
Mouse   138 IVEAM 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 44/135 (33%)
RRM_PPIL4 237..319 CDD:409681
PRK12678 344..>510 CDD:237171
U2AF_lg 467..>572 CDD:273727
PpiaNP_032933.1 cyclophilin_ABH_like 4..162 CDD:238907 44/135 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.