DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and cyp1

DIOPT Version :10

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_593308.1 Gene:cyp1 / 2543019 PomBaseID:SPAC57A10.03 Length:155 Species:Schizosaccharomyces pombe


Alignment Length:161 Identity:59/161 - (36%)
Similarity:90/161 - (55%) Gaps:8/161 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SVVIETTMGDLTVDLFISERPIACLNFLKLCRLKYYNFNLFHTVQQGFIAQTGDPSGAGDGGSSI 66
            :|.::|::|.:.::|:....|..|.||..|.:..||:..:||.|...|:.|.|||:|.|.||:||
pombe     3 NVELQTSLGKILIELYTEHAPKTCQNFYTLAKEGYYDGVIFHRVIPDFVIQGGDPTGTGRGGTSI 67

  Fly    67 WGVVEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTSLDGNHCVIGEVVE 131
            :|     .|  |:.|....::|:.||:||:.:||.|...||||:||... ..|||.|.:.|.||.
pombe    68 YG-----DK--FDDEIHSDLHHTGAGILSMANAGPNTNSSQFFITLAPT-PWLDGKHTIFGRVVS 124

  Fly   132 GHEVLRKLNDAIVDDSFRPYQDIRITHTVVL 162
            |..|.:::.....|.|.||.:.::|...|.|
pombe   125 GLSVCKRMGLIRTDSSDRPIEPLKIIKAVAL 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 58/159 (36%)
RRM_PPIL4 237..319 CDD:409681
PRK12678 344..>510 CDD:237171
U2AF_lg 467..>572 CDD:273727
cyp1NP_593308.1 cyclophilin 6..151 CDD:469651 56/152 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.