DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and ppi1

DIOPT Version :10

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_595664.1 Gene:ppi1 / 2540269 PomBaseID:SPBC28F2.03 Length:162 Species:Schizosaccharomyces pombe


Alignment Length:136 Identity:52/136 - (38%)
Similarity:72/136 - (52%) Gaps:15/136 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MGDLTVDLFISERPIACLNFLKLCR-LKYYNF--NLFHTVQQGFIAQTGD-PSGAGDGGSSIWGV 69
            :|.:...||....|....||..||. .|.|.:  :.||.|...|:.|.|| ..|.|.||.||:| 
pombe    15 LGRIVFKLFDDVVPKTAANFRALCTGEKGYGYAGSTFHRVIPQFMLQGGDFTRGNGTGGKSIYG- 78

  Fly    70 VEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTS-LDGNHCVIGEVVEGH 133
                 ::|.:..|  .:.|:..|:||:.:||.|..|||||:|  ..:|. |||.|.|.|||.||.
pombe    79 -----EKFPDENF--ALKHNKPGLLSMANAGPNTNGSQFFIT--TVVTPWLDGKHVVFGEVTEGM 134

  Fly   134 EVLRKL 139
            :|::|:
pombe   135 DVVKKV 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 52/136 (38%)
RRM_PPIL4 237..319 CDD:409681
PRK12678 344..>510 CDD:237171
U2AF_lg 467..>572 CDD:273727
ppi1NP_595664.1 cyclophilin_ABH_like 2..160 CDD:238907 52/136 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.