DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and Rbmy

DIOPT Version :9

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_001159856.1 Gene:Rbmy / 19657 MGIID:104732 Length:380 Species:Mus musculus


Alignment Length:390 Identity:87/390 - (22%)
Similarity:143/390 - (36%) Gaps:106/390 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 LFVCKLNPVTTDDDLEIIFSSFGVLKGCEVIRDRKTGDSLQYAFVEFEDQKSCEAAYFKMDNVLI 306
            :|:..||..|....|:.||..||.:....::|||:|..|..:||:.|......:.|..:|:.|::
Mouse    10 IFIGGLNIKTRQKTLQEIFGRFGPVARVILMRDRETKKSRGFAFLTFRRLADAKNAVKEMNGVIL 74

  Fly   307 DDRRIHV------------------DFSQS--VSKVTWRGKG------------RGIEGDYRKLD 339
            |.:||.|                  .||::  .|::...|:|            ..:.||....:
Mouse    75 DGKRIKVKQARRPSSLESGSKKRPPSFSRTRGASRILKCGRGGRSRARSGPSCEGNLGGDRYTPN 139

  Fly   340 FNNLRDDKDHRKPNNGRSRTEDHKERNRTEDFRNRMSSAERRKAREQRHQEQSERDVRKNLQR-R 403
            ||.....:......|..|:.:|...:...       :||:.|.....|.:|...|::.:|:.| .
Mouse   140 FNVSSSGRHFAVKRNPSSKRDDPPSKRSA-------TSAQTRSNTGLRGREPHRREISRNMPRGE 197

  Fly   404 TRSKEKDEKSVYR-----SKKSQNESV------------RENS-------------NRERNRNEK 438
            ..|..:||..:.|     |...:.||.            ||.|             .|:|:.:|.
Mouse   198 PASSRRDEYPLPRDYGQSSNDRKYESTSRGYCDYGNYHSREESASKVFSDHAGYLGGRDRDFSEY 262

  Fly   439 RSSRSRDATHRRYSRSRDREERRPSRPRDQLGRRSRSRDQKERR-----RSRPREQNERR-RSRS 497
            .|..|...|:|.|.|..:....|        |..:|..|....:     |..|...|... .|..
Mouse   263 LSGNSYRDTYRSYGRFHEAPSAR--------GGNNRYDDYSNSQDGYGGRGEPYISNRSNIYSSD 319

  Fly   498 RDQTGKR----PTQNRDRNDSRRFHSPQEGRRNDERSHRETSRNQRRSPERRQQSRNREDHRMDT 558
            .:::|::    |..:|:..|       :|||:  ||.|         ||:....|.:||.:..:|
Mouse   320 YERSGRQEVLPPPIDREYFD-------REGRQ--ERGH---------SPKDGLYSASRESYSSNT 366

  Fly   559  558
            Mouse   367  366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902
RRM <237..445 CDD:223796 59/265 (22%)
RRM_PPIL4 237..319 CDD:240681 26/96 (27%)
RbmyNP_001159856.1 RRM_SF 7..86 CDD:302621 24/75 (32%)
RRM <9..>85 CDD:223796 24/74 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..226 27/150 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 279..358 21/104 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.