DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and Ppic

DIOPT Version :10

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_032934.1 Gene:Ppic / 19038 MGIID:97751 Length:212 Species:Mus musculus


Alignment Length:164 Identity:54/164 - (32%)
Similarity:85/164 - (51%) Gaps:15/164 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MGDLTVDLFISERPIACLNFLKLCR-LKYYNF--NLFHTVQQGFIAQTGD-PSGAGDGGSSIWGV 69
            :|.:.:.||.:..|....||:.|.. .|.|.:  ::||.|.:.|:.|.|| .:..|.||.||:| 
Mouse    51 VGRIVIGLFGNVVPKTVENFVALATGEKGYGYKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYG- 114

  Fly    70 VEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTSLDGNHCVIGEVVEGHE 134
                 :.|.:..|  |:.|...|.:|:.:||.:..|||||:||.:. |.|||.|.|.|:|::|..
Mouse   115 -----ETFPDENF--KLKHYGIGWVSMANAGPDTNGSQFFITLTKP-TWLDGKHVVFGKVLDGMT 171

  Fly   135 VLRKLNDAIVDDSFRPYQDIRITHT--VVLEDPF 166
            |:..:.....|...||..|..|.::  :.::.||
Mouse   172 VVHSIELQATDGHDRPLTDCTIVNSGKIDVKTPF 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 54/164 (33%)
RRM_PPIL4 237..319 CDD:409681
PRK12678 344..>510 CDD:237171
U2AF_lg 467..>572 CDD:273727
PpicNP_032934.1 cyclophilin_ABH_like 38..197 CDD:238907 52/154 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.