DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and cyn-3

DIOPT Version :9

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_506751.1 Gene:cyn-3 / 180028 WormBaseID:WBGene00000879 Length:173 Species:Caenorhabditis elegans


Alignment Length:158 Identity:51/158 - (32%)
Similarity:78/158 - (49%) Gaps:21/158 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GDLTVDLFISERPIACLNFLKLC----------RLKYYNFNLFHTVQQGFIAQTGD-PSGAGDGG 63
            |.:.::|:....|....||..||          :..::..:.||.:...|:.|.|| ..|.|.||
 Worm    18 GRIVMELYDDVVPKTAGNFRALCTGENGIGKSGKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGG 82

  Fly    64 SSIWGVVEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTSLDGNHCVIGE 128
            .||:|      ::|.:..|  |..|:..|:||:.:||.|..||||||...:. ..|||.|.|.|.
 Worm    83 ESIYG------EKFPDENF--KEKHTGPGVLSMANAGPNTNGSQFFLCTVKT-EWLDGKHVVFGR 138

  Fly   129 VVEGHEVLRKLNDAIVDDSFRPYQDIRI 156
            ||||.:|::.: ::....|.:|.:|..|
 Worm   139 VVEGLDVVKAV-ESNGSQSGKPVKDCMI 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 51/158 (32%)
RRM <237..445 CDD:223796
RRM_PPIL4 237..319 CDD:240681
cyn-3NP_506751.1 cyclophilin_ABH_like 4..169 CDD:238907 51/158 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.