DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and cyn-1

DIOPT Version :10

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_506561.1 Gene:cyn-1 / 179936 WormBaseID:WBGene00000877 Length:192 Species:Caenorhabditis elegans


Alignment Length:145 Identity:46/145 - (31%)
Similarity:68/145 - (46%) Gaps:20/145 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ETTMGDLTVDLFISERPIACLNFLKLCR----------LKYYNFNLFHTVQQGFIAQTGD-PSGA 59
            |...|.:|::||....|....||..||.          ..::..:.||.:...|:.|.|| ....
 Worm    32 EEPAGRVTMELFNDVVPKTAENFRALCTGEKGVGEQGVALHFKGSKFHRIIPEFMIQGGDFTRHN 96

  Fly    60 GDGGSSIWGVVEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTSLDGNHC 124
            |.||.||:|      .:|.:..|  .:.|:..|.||:.:||.|..|||||:...:. ..|||.|.
 Worm    97 GTGGESIYG------NKFKDENF--DLKHTGPGCLSMANAGPNTNGSQFFICTVDT-PWLDGGHV 152

  Fly   125 VIGEVVEGHEVLRKL 139
            |.|:|.:|..|::|:
 Worm   153 VFGQVTDGMSVVKKI 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 46/145 (32%)
RRM_PPIL4 237..319 CDD:409681
PRK12678 344..>510 CDD:237171
U2AF_lg 467..>572 CDD:273727
cyn-1NP_506561.1 cyclophilin_ABH_like 22..187 CDD:238907 46/145 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.