DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and Ppif

DIOPT Version :10

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_598845.1 Gene:Ppif / 105675 MGIID:2145814 Length:206 Species:Mus musculus


Alignment Length:136 Identity:48/136 - (35%)
Similarity:69/136 - (50%) Gaps:15/136 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MGDLTVDLFISERPIACLNFLKLCRLKY---YNFNLFHTVQQGFIAQTGD-PSGAGDGGSSIWGV 69
            :|.:.::|.....|....||..||..:.   |..:.||.|...|:.|.|| .:..|.||.||:| 
Mouse    58 LGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPAFMCQAGDFTNHNGTGGRSIYG- 121

  Fly    70 VEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFL-TLGENLTSLDGNHCVIGEVVEGH 133
                 .||.:..|  .:.|...|:||:.:||.|..|||||: |:..:.  |||.|.|.|.|.||.
Mouse   122 -----SRFPDENF--TLKHVGPGVLSMANAGPNTNGSQFFICTIKTDW--LDGKHVVFGHVKEGM 177

  Fly   134 EVLRKL 139
            :|::|:
Mouse   178 DVVKKI 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 48/136 (35%)
RRM_PPIL4 237..319 CDD:409681
PRK12678 344..>510 CDD:237171
U2AF_lg 467..>572 CDD:273727
PpifNP_598845.1 cyclophilin_ABH_like 45..203 CDD:238907 48/136 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.