DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and PPIH

DIOPT Version :10

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_006338.1 Gene:PPIH / 10465 HGNCID:14651 Length:177 Species:Homo sapiens


Alignment Length:151 Identity:47/151 - (31%)
Similarity:79/151 - (52%) Gaps:18/151 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MGDLTVDLFISERPIACLNFLKLCRLKY--------YNFNLFHTVQQGFIAQTGD-PSGAGDGGS 64
            :|.:.::||....|....||.:.|..::        |..:.||.|.:.|:.|.|| .:|.|.|.:
Human    24 VGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVA 88

  Fly    65 SIWGVVEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTSLDGNHCVIGEV 129
            ||:   .||   |.:..|  |:.||:.|:||:.::|.:..|.|||:|..: ...|||.|.|.|::
Human    89 SIY---RGP---FADENF--KLRHSAPGLLSMANSGPSTNGCQFFITCSK-CDWLDGKHVVFGKI 144

  Fly   130 VEGHEVLRKLNDAIVDDSFRP 150
            ::|..|:||:.:.....:.:|
Human   145 IDGLLVMRKIENVPTGPNNKP 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 47/151 (31%)
RRM_PPIL4 237..319 CDD:409681
PRK12678 344..>510 CDD:237171
U2AF_lg 467..>572 CDD:273727
PPIHNP_006338.1 cyclophilin 8..177 CDD:469651 47/151 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.