DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5808 and PPIF

DIOPT Version :10

Sequence 1:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_005720.1 Gene:PPIF / 10105 HGNCID:9259 Length:207 Species:Homo sapiens


Alignment Length:154 Identity:53/154 - (34%)
Similarity:77/154 - (50%) Gaps:16/154 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MGDLTVDLFISERPIACLNFLKLCRLKY---YNFNLFHTVQQGFIAQTGD-PSGAGDGGSSIWGV 69
            :|.:.::|.....|....||..||..:.   |..:.||.|...|:.|.|| .:..|.||.||:| 
Human    59 LGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYG- 122

  Fly    70 VEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFL-TLGENLTSLDGNHCVIGEVVEGH 133
                 .||.:..|  .:.|...|:||:.:||.|..|||||: |:..:.  |||.|.|.|.|.||.
Human   123 -----SRFPDENF--TLKHVGPGVLSMANAGPNTNGSQFFICTIKTDW--LDGKHVVFGHVKEGM 178

  Fly   134 EVLRKLNDAIVDDSFRPYQDIRIT 157
            :|::|: ::....|.|..:.|.||
Human   179 DVVKKI-ESFGSKSGRTSKKIVIT 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 53/154 (34%)
RRM_PPIL4 237..319 CDD:409681
PRK12678 344..>510 CDD:237171
U2AF_lg 467..>572 CDD:273727
PPIFNP_005720.1 cyclophilin_ABH_like 46..204 CDD:238907 53/154 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.