DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6980 and AT1G56090

DIOPT Version :10

Sequence 1:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001321310.1 Gene:AT1G56090 / 842061 AraportID:AT1G56090 Length:346 Species:Arabidopsis thaliana


Alignment Length:116 Identity:37/116 - (31%)
Similarity:61/116 - (52%) Gaps:9/116 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 QGNEAFRSQKYEKAILHYDKAI--IKVKDSAIT-YCNRALCYIKLQNYKRALKDCQYVLEKLQES 195
            :|::.:|..||::|:|.|.:|:  .|.|...|. :.|||.||:||.::.:|.::|..||| |.:.
plant    87 KGHQLYRDGKYKEALLFYTEALTAAKAKPQKIALHSNRAACYLKLHDFIKAAEECTCVLE-LDQK 150

  Fly   196 NLRAWLYQAHAYKGLKQDDKFEESVVKAREHNPKQLAYIDKYIKQLEADLK 246
            :..|.:.:|.....||:.......|.:..|.||....|     :.|||.|:
plant   151 HSGALMLRAQTLVTLKEYQSALFDVTRLMELNPDSEVY-----QNLEARLR 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6980NP_651289.1 Spy 117..>233 CDD:443119 32/101 (32%)
TPR repeat 128..156 CDD:276809 8/23 (35%)
TPR repeat 161..192 CDD:276809 13/31 (42%)
TPR repeat 197..225 CDD:276809 5/27 (19%)
AT1G56090NP_001321310.1 TPR repeat 86..112 CDD:276809 8/24 (33%)
TPR 87..>191 CDD:440225 33/109 (30%)
TPR repeat 117..147 CDD:276809 13/30 (43%)
TPR repeat 152..180 CDD:276809 5/27 (19%)

Return to query results.
Submit another query.