DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6980 and TPR13

DIOPT Version :10

Sequence 1:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_196571.1 Gene:TPR13 / 830873 AraportID:AT5G10090 Length:594 Species:Arabidopsis thaliana


Alignment Length:149 Identity:39/149 - (26%)
Similarity:70/149 - (46%) Gaps:26/149 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 FMEQVEK-------DANDRAEA----RAKAEYEAELQRSQGNEAFRSQKYEKAILHYDKAIIKVK 159
            |:|.||.       |.|:|..:    ||:|...|   ||:||:.|::.::::|...|.:.:....
plant   441 FVEAVEAIQRAGKLDGNNREVSMVLRRAQAVTAA---RSRGNDFFKAGRFQEACTAYGEGLDHDS 502

  Fly   160 DSAITYCNRALCYIKLQNYKRALKDCQ--------YVLEKLQESNLRA----WLYQAHAYKGLKQ 212
            .:::..||||.|..|:..:.||::|..        |...:|:.::..|    |......|:.|::
plant   503 RNSVLLCNRAACLSKMGQFDRAVEDTSAALAVRPGYTKARLRRADCNAKLGNWESAVGDYEILRK 567

  Fly   213 DDKFEESVVKAREHNPKQL 231
            :...:|.|:|......|||
plant   568 ETPEDEEVIKGLSEAQKQL 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6980NP_651289.1 Spy 117..>233 CDD:443119 33/131 (25%)
TPR repeat 128..156 CDD:276809 8/27 (30%)
TPR repeat 161..192 CDD:276809 10/38 (26%)
TPR repeat 197..225 CDD:276809 7/31 (23%)
TPR13NP_196571.1 TPR repeat 237..265 CDD:276809
TPR repeat 270..300 CDD:276809
LapB 280..568 CDD:442196 33/129 (26%)
TPR repeat 305..331 CDD:276809
TPR 432..>586 CDD:440225 37/147 (25%)
TPR repeat 473..499 CDD:276809 8/28 (29%)
TPR repeat 504..534 CDD:276809 9/29 (31%)
TPR repeat 539..563 CDD:276809 3/23 (13%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.