DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6980 and TTC4

DIOPT Version :9

Sequence 1:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_004614.3 Gene:TTC4 / 7268 HGNCID:12394 Length:387 Species:Homo sapiens


Alignment Length:193 Identity:51/193 - (26%)
Similarity:88/193 - (45%) Gaps:41/193 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 RKSLEEDN-EKQVKDMNQKSFMEQVEKDANDRA-------------EARAKAEYEAELQRSQGNE 137
            |....||. ||:.:.:  ..||.:...:.:.|.             |.|:..| :|:..:.:||:
Human    27 RGGFHEDQWEKEFEKV--PLFMSRAPSEIDPRENPDLACLQSIIFDEERSPEE-QAKTYKDEGND 88

  Fly   138 AFRSQKYEKAILHYDKAI-IKVKD---SAITYCNRALCYIKLQNYKRALKDCQYVLEKLQESNLR 198
            .|:.:.|:||::.|.:.: .|..|   :|:.|.|||.....|.|::.||.|.. ...||:..:|:
Human    89 YFKEKDYKKAVISYTEGLKKKCADPDLNAVLYTNRAAAQYYLGNFRSALNDVT-AARKLKPCHLK 152

  Fly   199 AWLYQAHAYKGLKQDDKFEESV--------VKAREHNPKQL-AYIDKYIKQLE------ADLK 246
            |.:..|..:..||.   |.|:|        :.|:|....:: |..|| :|::|      |:||
Human   153 AIIRGALCHLELKH---FAEAVNWCDEGLQIDAKEKKLLEMRAKADK-LKRIEQRDVRKANLK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6980NP_651289.1 TPR_11 127..190 CDD:290150 20/66 (30%)
TPR repeat 128..156 CDD:276809 8/28 (29%)
TPR repeat 161..192 CDD:276809 10/30 (33%)
TPR_1 162..190 CDD:278916 10/27 (37%)
TPR repeat 197..225 CDD:276809 9/35 (26%)
TTC4NP_004614.3 TPR_11 78..148 CDD:290150 22/70 (31%)
TPR 1 79..112 9/32 (28%)
TPR repeat 79..107 CDD:276809 8/27 (30%)
TPR repeat 116..146 CDD:276809 10/30 (33%)
TPR 2 117..150 12/33 (36%)
TPR_16 123..181 CDD:290168 17/61 (28%)
TPR 3 151..184 9/35 (26%)
TPR repeat 151..179 CDD:276809 8/30 (27%)
NinG 173..>236 CDD:283434 10/40 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R218
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.