DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6980 and Tomm34

DIOPT Version :10

Sequence 1:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_080272.1 Gene:Tomm34 / 67145 MGIID:1914395 Length:309 Species:Mus musculus


Alignment Length:125 Identity:42/125 - (33%)
Similarity:63/125 - (50%) Gaps:11/125 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 SLEEDNEKQVKDMNQKSFMEQVEK--DANDRAEARAKAEYEAELQRSQGNEAFRSQKYEKAILHY 151
            ||..||.|:......|.......:  .|.|...|:|..|        :||:..:...::|||..|
Mouse   160 SLPSDNHKETAKTKSKEATATKSRVPSAGDVERAKALKE--------EGNDLVKKGNHKKAIEKY 216

  Fly   152 DKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQYVLEKLQESNLRAWLYQAHAYKGLK 211
            .::::.....:.||.|||||::.|:.||.|:|||...| ||...|::|:..:|.|||.||
Mouse   217 SESLLCSSLESATYSNRALCHLVLKQYKEAVKDCTEAL-KLDGKNVKAFYRRAQAYKALK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6980NP_651289.1 Spy 117..>233 CDD:443119 34/95 (36%)
TPR repeat 128..156 CDD:276809 6/27 (22%)
TPR repeat 161..192 CDD:276809 15/30 (50%)
TPR repeat 197..225 CDD:276809 7/15 (47%)
Tomm34NP_080272.1 TPR 1 9..42
TPR repeat 9..37 CDD:276809
3a0801s09 <12..>294 CDD:273380 42/125 (34%)
TPR repeat 50..80 CDD:276809
TPR 2 51..84
TPR 3 85..118
TPR repeat 85..113 CDD:276809
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..189 7/28 (25%)
TPR 4 193..226 9/40 (23%)
TPR repeat 193..221 CDD:276809 9/35 (26%)
TPR repeat 226..256 CDD:276809 15/30 (50%)
TPR 5 227..260 17/33 (52%)
TPR 6 261..294 7/15 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.