DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6980 and TTC31

DIOPT Version :9

Sequence 1:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_011531337.1 Gene:TTC31 / 64427 HGNCID:25759 Length:539 Species:Homo sapiens


Alignment Length:104 Identity:27/104 - (25%)
Similarity:48/104 - (46%) Gaps:11/104 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 AELQRSQ-----GNEAFRSQKYEKAILHYDKAI-IKVKDSAITYCNRALCYIKLQNYKRALKDCQ 186
            |.||:||     |....::..|.:|::.:.:|: :..:|..: :.||:.|:.:|.....||.|.|
Human   320 AALQQSQELAKLGTSFAQNGFYHEAVVLFTQALKLNPQDHRL-FGNRSFCHERLGQPAWALADAQ 383

  Fly   187 YVLEKLQESNLRAWLYQAHAYKGLKQDDKFEESVVKARE 225
            ..| .|:....|.......|..||:   :|.|:....:|
Human   384 VAL-TLRPGWPRGLFRLGKALMGLQ---RFREAAAVFQE 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6980NP_651289.1 TPR_11 127..190 CDD:290150 18/67 (27%)
TPR repeat 128..156 CDD:276809 9/33 (27%)
TPR repeat 161..192 CDD:276809 9/30 (30%)
TPR_1 162..190 CDD:278916 8/27 (30%)
TPR repeat 197..225 CDD:276809 6/27 (22%)
TTC31XP_011531337.1 TPR_11 324..390 CDD:290150 17/67 (25%)
TPR repeat 325..353 CDD:276809 6/27 (22%)
TPR repeat 358..388 CDD:276809 10/31 (32%)
TPR repeat 393..421 CDD:276809 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.