DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6980 and zgc:123010

DIOPT Version :9

Sequence 1:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_005169572.1 Gene:zgc:123010 / 641500 ZFINID:ZDB-GENE-051120-15 Length:501 Species:Danio rerio


Alignment Length:214 Identity:47/214 - (21%)
Similarity:85/214 - (39%) Gaps:44/214 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DDEDSKAGGDAK----EKINFDNLDVDKVRLKV-----------------KENRTVINRKSLEED 93
            ::|:..||.|::    |:...:.:.|.||..|.                 |.||.. ..:|.|||
Zfish    97 EEEEDDAGPDSELDESEESELEEVVVSKVEEKPVALLNKSPSGPPLASGNKSNRQQ-GARSGEED 160

  Fly    94 NEKQVKDMNQKSFMEQVEKDANDRAEARAKAE-----------YEAELQRS-----QGNEAFRSQ 142
            ....|......:.:..:...|..:.:::...|           .||:.:||     :|....:..
Zfish   161 PGWDVNSAFVANAVSHIRPKAKSKGKSKENKENESRPAEVIGFSEAKTKRSASLVEKGIRFVQEG 225

  Fly   143 KYEKAILHYDKAI-IKVKDSAITYCNRALCYIKLQNYKRALKDCQYVLEKLQESNLRAWLYQAHA 206
            :|.:|:..:.:|| ...||... :.||:.||..|:.|..||.|.:..::...:.. :.:..:..|
Zfish   226 QYTQAVSLFTEAIKCDPKDYRF-FGNRSYCYCCLEQYALALADAEKSIQMAPDWP-KGYYRRGSA 288

  Fly   207 YKGLK---QDDKFEESVVK 222
            ..|||   :.:|..|.|:|
Zfish   289 LMGLKRYSEAEKAMEQVLK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6980NP_651289.1 TPR_11 127..190 CDD:290150 20/68 (29%)
TPR repeat 128..156 CDD:276809 8/33 (24%)
TPR repeat 161..192 CDD:276809 9/30 (30%)
TPR_1 162..190 CDD:278916 9/27 (33%)
TPR repeat 197..225 CDD:276809 8/29 (28%)
zgc:123010XP_005169572.1 TPR_11 214..276 CDD:290150 16/62 (26%)
TPR repeat 214..239 CDD:276809 4/24 (17%)
TPR repeat 244..274 CDD:276809 10/30 (33%)
TPR_11 250..309 CDD:290150 17/59 (29%)
TPR_2 279..309 CDD:285020 8/30 (27%)
TPR repeat 279..307 CDD:276809 7/28 (25%)
TPR_11 282..343 CDD:290150 8/26 (31%)
TPR repeat 313..343 CDD:276809
RRM <364..>438 CDD:223796
RRM 370..436 CDD:214636
zf-CCCH 471..492 CDD:279036
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.