DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6980 and ttc12

DIOPT Version :9

Sequence 1:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_009289931.1 Gene:ttc12 / 563791 ZFINID:ZDB-GENE-071016-4 Length:707 Species:Danio rerio


Alignment Length:225 Identity:67/225 - (29%)
Similarity:115/225 - (51%) Gaps:14/225 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AEFEATLAKIDCILQNKAPCDDEDSKAGGDAKEKINFDNLD---VDKVRLKVKENRTVINRKSLE 91
            ::.|..|..:|.|  |:...|...|:|.......:..:.|.   ..|.:.|.|.|:||||..|.|
Zfish    12 SDLEKFLRDVDQI--NELVRDLNSSEASCQENAIVKTEQLISSLEQKEQFKTKINKTVINTSSSE 74

  Fly    92 ED--NEKQVKDMNQKSFMEQVEKDANDRAEARAKAEYEAELQRSQGNEAFRSQKYEKAILHYDKA 154
            .:  |.:.....|.::|::.:||||.||.:.|...|..|.:.|.||||||....||.|:..|.:.
Zfish    75 NNPLNIRYESSQNPENFLKILEKDAEDRCQRRKMKEERANVLREQGNEAFTQGDYETAVRFYTEG 139

  Fly   155 IIKVKDSAITYCNRALCYIKLQNYKRALKDCQYVLEKLQESNLRAWLYQAHAYKGLKQDDKFEES 219
            :.:::|....|.|||..:|||:.||.|:.||::.| :..|..::|:::...::..||.   |.:|
Zfish   140 LEQLRDMQALYTNRAQAFIKLKRYKEAISDCEWAL-RCNEKCIKAFIHMGTSHLALKD---FTQS 200

  Fly   220 VV---KAREHNPKQLAYIDKYIKQLEADLK 246
            .:   |..|..|::...:..|:::::.:.|
Zfish   201 RICYRKILEIEPQRETMVKAYLRRVDMEEK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6980NP_651289.1 TPR_11 127..190 CDD:290150 25/62 (40%)
TPR repeat 128..156 CDD:276809 12/27 (44%)
TPR repeat 161..192 CDD:276809 13/30 (43%)
TPR_1 162..190 CDD:278916 12/27 (44%)
TPR repeat 197..225 CDD:276809 6/30 (20%)
ttc12XP_009289931.1 TPR_11 112..178 CDD:290150 26/66 (39%)
TPR repeat 113..141 CDD:276809 12/27 (44%)
TPR repeat 146..176 CDD:276809 13/30 (43%)
TPR_11 149..212 CDD:290150 21/66 (32%)
TPR_1 150..180 CDD:278916 14/30 (47%)
TPR repeat 181..209 CDD:276809 6/30 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11095
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005389
OrthoInspector 1 1.000 - - otm26027
orthoMCL 1 0.900 - - OOG6_108547
Panther 1 1.100 - - LDO PTHR46540
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R218
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.940

Return to query results.
Submit another query.