DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6980 and si:dkey-33c12.4

DIOPT Version :9

Sequence 1:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_021336269.1 Gene:si:dkey-33c12.4 / 560112 ZFINID:ZDB-GENE-030131-2527 Length:648 Species:Danio rerio


Alignment Length:263 Identity:54/263 - (20%)
Similarity:100/263 - (38%) Gaps:49/263 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DNAQLKATMLNCNLNPSVADDFAEFEATLAKIDCILQNKAPCDDEDSKAGGDAKEKINFDNLDVD 72
            :|...|.....|:   ||..|.....|.::..|      :..|:||.|....|.|.   :.||::
Zfish   195 ENKDKKCKNKGCS---SVPPDPQPISAPVSSSD------SSSDEEDDKKEDSAIEP---EELDMN 247

  Fly    73 KVRLKVKENRTVINRKSLEED----------NEKQVKDMNQKSFMEQVEKDANDRAEARAKAEYE 127
            ...:   .|...|.::.||:.          |.|:..:..||:.:...::.|.:...........
Zfish   248 SCFV---SNAAAIAKRKLEQKPKPDKKPAQANPKKQHESQQKATVMPQKQVAKEEVNGEESVNAN 309

  Fly   128 AELQRSQ-----GNEAFRSQKYEKAILHYDKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQY 187
            ..:.||.     |||...|...|.|:.::..||.........:.||:.||.|:..|:::|.|.:.
Zfish   310 DFITRSVELAVIGNEYAGSGNMEMAVKYFTDAIKHNPKEYKLFGNRSYCYEKMLQYEKSLTDAEI 374

  Fly   188 VLEKLQESNLRAWLYQAHAYKGLKQDDKFEESVVKAREHNPKQLAY-----IDKYIKQLEADLKA 247
            .|     |....|:      |||.:..:   ::|..:.:|..:|.:     :|...|....::..
Zfish   375 AL-----SMNPKWI------KGLYRKGR---ALVGLKRYNEARLTFGEVLKLDSSCKDAAEEIMR 425

  Fly   248 LEI 250
            :::
Zfish   426 VQL 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6980NP_651289.1 TPR_11 127..190 CDD:290150 18/67 (27%)
TPR repeat 128..156 CDD:276809 9/32 (28%)
TPR repeat 161..192 CDD:276809 9/30 (30%)
TPR_1 162..190 CDD:278916 8/27 (30%)
TPR repeat 197..225 CDD:276809 5/27 (19%)
si:dkey-33c12.4XP_021336269.1 PLN03088 258..>439 CDD:330826 36/185 (19%)
TPR repeat 348..378 CDD:276809 9/34 (26%)
TPR repeat 383..411 CDD:276809 6/36 (17%)
UBA 430..456 CDD:270456
RRM <471..>614 CDD:223796
RRM 519..584 CDD:214636
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.