DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6980 and ttc9b

DIOPT Version :9

Sequence 1:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001038370.1 Gene:ttc9b / 559732 ZFINID:ZDB-GENE-050419-67 Length:243 Species:Danio rerio


Alignment Length:165 Identity:34/165 - (20%)
Similarity:65/165 - (39%) Gaps:56/165 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 NEKQVKDMNQKSFMEQVEKDANDRAEAR--------------AKAEYEAELQRS-----QGNEAF 139
            :|.:.|..:.||.....|......|.|.              |:.:.||::|::     :|:..:
Zfish    24 SEMEAKQHSIKSLKSYPEAGGRSLAAAAGGDGGGGVGYRVGGAEMDMEAKIQKAIDFKLEGHRCY 88

  Fly   140 RSQKYEKAILHYDKAIIKVK---------DSAITYCNRAL-----------------CY------ 172
            :.:|:.:||..|.:|::::|         .|.:...|:|.                 ||      
Zfish    89 KEKKFREAIGKYHRALLQLKGIHVVDGTTGSEVNLLNQAAAKLTEEQRRAVESTEIECYDSLTAC 153

  Fly   173 ---IKLQNYKRALKDCQYVLEKLQESNLRAWLYQA 204
               .:|.||:|..:.|..||.. |:.:.:| :|:|
Zfish   154 LLQSELVNYERVKEYCLKVLGH-QQDHFKA-MYRA 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6980NP_651289.1 TPR_11 127..190 CDD:290150 21/102 (21%)
TPR repeat 128..156 CDD:276809 8/32 (25%)
TPR repeat 161..192 CDD:276809 12/56 (21%)
TPR_1 162..190 CDD:278916 10/53 (19%)
TPR repeat 197..225 CDD:276809 3/8 (38%)
ttc9bNP_001038370.1 TPR repeat 77..138 CDD:276809 10/60 (17%)
PEP_TPR_lipo <82..>229 CDD:274350 23/107 (21%)
TPR repeat 143..175 CDD:276809 9/31 (29%)
TPR repeat 180..206 CDD:276809 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.