| Sequence 1: | NP_651289.1 | Gene: | CG6980 / 42955 | FlyBaseID: | FBgn0039228 | Length: | 250 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001007767.1 | Gene: | stip1 / 493606 | ZFINID: | ZDB-GENE-041121-17 | Length: | 542 | Species: | Danio rerio |
| Alignment Length: | 214 | Identity: | 54/214 - (25%) |
|---|---|---|---|
| Similarity: | 87/214 - (40%) | Gaps: | 46/214 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 64 INFDNLDVDKVR------LKV-KENR----------TVINRKSLEEDNEKQVKDMNQKSFMEQVE 111
Fly 112 KDANDRAEARAKAEYEAEL-----------QRSQGNEAFRSQKYEKAILHYDKAIIKVKDSAITY 165
Fly 166 CNRALCYIKLQNYKRALKDCQYVLEKLQESNLRAWLYQAHAYKGLKQDDKFEESVVKAREHNPKQ 230
Fly 231 LAYIDKYIKQLEADLKALE 249 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6980 | NP_651289.1 | TPR_11 | 127..190 | CDD:290150 | 25/73 (34%) |
| TPR repeat | 128..156 | CDD:276809 | 10/38 (26%) | ||
| TPR repeat | 161..192 | CDD:276809 | 13/30 (43%) | ||
| TPR_1 | 162..190 | CDD:278916 | 13/27 (48%) | ||
| TPR repeat | 197..225 | CDD:276809 | 4/27 (15%) | ||
| stip1 | NP_001007767.1 | TPR_11 | 7..69 | CDD:290150 | |
| TPR | 7..37 | CDD:197478 | |||
| TPR repeat | 7..32 | CDD:276809 | |||
| TPR repeat | 37..67 | CDD:276809 | |||
| TPR_11 | 40..103 | CDD:290150 | |||
| TPR repeat | 72..100 | CDD:276809 | |||
| TPR_11 | 224..285 | CDD:290150 | 5/17 (29%) | ||
| TPR repeat | 228..252 | CDD:276809 | |||
| TPR_1 | 230..257 | CDD:278916 | |||
| TPR_12 | 254..327 | CDD:290160 | 13/59 (22%) | ||
| TPR repeat | 257..287 | CDD:276809 | 5/19 (26%) | ||
| TPR | 299..327 | CDD:197478 | 4/27 (15%) | ||
| TPR repeat | 299..326 | CDD:276809 | 3/26 (12%) | ||
| TPR_11 | 359..423 | CDD:290150 | 24/69 (35%) | ||
| TPR repeat | 363..387 | CDD:276809 | 9/23 (39%) | ||
| TPR repeat | 392..422 | CDD:276809 | 13/35 (37%) | ||
| TPR_1 | 427..459 | CDD:278916 | 10/43 (23%) | ||
| TPR repeat | 427..455 | CDD:276809 | 7/39 (18%) | ||
| STI1 | 491..530 | CDD:128966 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0548 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.810 | |||||