Sequence 1: | NP_651289.1 | Gene: | CG6980 / 42955 | FlyBaseID: | FBgn0039228 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_989360.1 | Gene: | stip1 / 394990 | XenbaseID: | XB-GENE-958361 | Length: | 543 | Species: | Xenopus tropicalis |
Alignment Length: | 196 | Identity: | 51/196 - (26%) |
---|---|---|---|
Similarity: | 90/196 - (45%) | Gaps: | 34/196 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 KVKENRTVIN--RKSLEEDNEKQVKDMNQKSFMEQVEKDANDRAEARAKAEYEAELQRSQGNEAF 139
Fly 140 RSQKYEKAILHYDKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQYVLEKLQESNLRAWLYQA 204
Fly 205 HAYKGLKQDDKFEESVVKARE--------------------------HNPKQLAYIDKYIKQLEA 243
Fly 244 D 244 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6980 | NP_651289.1 | TPR_11 | 127..190 | CDD:290150 | 26/62 (42%) |
TPR repeat | 128..156 | CDD:276809 | 10/27 (37%) | ||
TPR repeat | 161..192 | CDD:276809 | 14/30 (47%) | ||
TPR_1 | 162..190 | CDD:278916 | 14/27 (52%) | ||
TPR repeat | 197..225 | CDD:276809 | 6/27 (22%) | ||
stip1 | NP_989360.1 | 3a0801s09 | <2..532 | CDD:273380 | 51/196 (26%) |
TPR repeat | 4..32 | CDD:276809 | |||
TPR repeat | 37..67 | CDD:276809 | |||
TPR repeat | 72..100 | CDD:276809 | |||
TPR repeat | 225..253 | CDD:276809 | |||
TPR repeat | 258..288 | CDD:276809 | |||
TPR repeat | 300..328 | CDD:276809 | 5/15 (33%) | ||
TPR repeat | 364..388 | CDD:276809 | 10/23 (43%) | ||
TPR repeat | 393..423 | CDD:276809 | 14/30 (47%) | ||
TPR repeat | 428..456 | CDD:276809 | 6/27 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |