DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6980 and stip1

DIOPT Version :9

Sequence 1:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_989360.1 Gene:stip1 / 394990 XenbaseID:XB-GENE-958361 Length:543 Species:Xenopus tropicalis


Alignment Length:196 Identity:51/196 - (26%)
Similarity:90/196 - (45%) Gaps:34/196 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 KVKENRTVIN--RKSLEEDNEKQVKDMNQKSFMEQVEKDANDRAEARAKAEYEAELQRSQGNEAF 139
            |.::|:..|:  .|||.|....:|....|::  |::.|:....|........|   ::|:|||:|
 Frog   312 KEEKNKEAIHFFNKSLAEHRTPEVLKKCQQA--EKILKEQERLAYINPDLALE---EKSKGNESF 371

  Fly   140 RSQKYEKAILHYDKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQYVLEKLQESNLRAWLYQA 204
            :...|.:|:.||.:||.:..:.|..|.|||.||.||..::.|||||:..: :|:...::.:..:|
 Frog   372 QKGDYPQAMKHYTEAIKRNPNDAKLYSNRAACYTKLLEFQLALKDCEECI-RLEPKFIKGYTRKA 435

  Fly   205 HAYKGLKQDDKFEESVVKARE--------------------------HNPKQLAYIDKYIKQLEA 243
            .|.:.:|...|..:...||.|                          .:.|:.|..|..::|:.:
 Frog   436 AALEAMKDYSKAMDVYQKAMELDSTCKEATDGYQRCMMSQYHRNDSPEDVKRRAMADPEVQQIMS 500

  Fly   244 D 244
            |
 Frog   501 D 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6980NP_651289.1 TPR_11 127..190 CDD:290150 26/62 (42%)
TPR repeat 128..156 CDD:276809 10/27 (37%)
TPR repeat 161..192 CDD:276809 14/30 (47%)
TPR_1 162..190 CDD:278916 14/27 (52%)
TPR repeat 197..225 CDD:276809 6/27 (22%)
stip1NP_989360.1 3a0801s09 <2..532 CDD:273380 51/196 (26%)
TPR repeat 4..32 CDD:276809
TPR repeat 37..67 CDD:276809
TPR repeat 72..100 CDD:276809
TPR repeat 225..253 CDD:276809
TPR repeat 258..288 CDD:276809
TPR repeat 300..328 CDD:276809 5/15 (33%)
TPR repeat 364..388 CDD:276809 10/23 (43%)
TPR repeat 393..423 CDD:276809 14/30 (47%)
TPR repeat 428..456 CDD:276809 6/27 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.